PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.10040s0256.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family ARF
Protein Properties Length: 663aa    MW: 73644.6 Da    PI: 5.9803
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.10040s0256.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.81.5e-21124225199
                           EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                           f+k+lt sd++++g +++ +++a+++       +++    ++l+ +d+++ +W +++i+r++++r++lt+GW+ Fv++++L +gD ++F
  Bostr.10040s0256.2.p 124 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIF 210
                           99****************************964333..4459*********************************************** PP

                           EE-SSSEE..EEEEE-S CS
                    B3  83 kldgrsefelvvkvfrk 99 
                              + +++el+v+v+r+
  Bostr.10040s0256.2.p 211 L--RGENEELRVGVRRH 225
                           *..3488889****996 PP

2Auxin_resp112.83.3e-37250332183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                           aaha++t+++F+v+Y+Pr+s+seF+v+v+++++a ++k+svGmRfkm+fe+e+++e+r+sGt+vgv++ +++ W++S+WrsLk
  Bostr.10040s0256.2.p 250 AAHAIKTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEKRFSGTIVGVQENKSSVWHDSEWRSLK 332
                           79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.81E-44113253IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.8E-40121239IPR015300DNA-binding pseudobarrel domain
CDDcd100176.14E-19122224No hitNo description
PROSITE profilePS5086310.518124226IPR003340B3 DNA binding domain
PfamPF023622.2E-19124225IPR003340B3 DNA binding domain
SMARTSM010191.6E-20124226IPR003340B3 DNA binding domain
PfamPF065073.2E-34250332IPR010525Auxin response factor
PfamPF023091.7E-11534629IPR033389AUX/IAA domain
PROSITE profilePS5174530.558539632IPR000270PB1 domain
SuperFamilySSF542771.63E-11541616No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MAASNHSSGR PGGVLSDALC RELWHACAGP LVTLPREWER VYYFPEGHME QLEASMHQGL  60
EQQMPSFDLP SKILCKVINI ERRAEPETDE VYAQITLLPE LDQSEPISPD APVQEPEKCT  120
VHSFCKTLTA SDTSTHGGFS VLRRHADDCL PPLDMSQQPP WQELVATDLH NSEWHFRHIF  180
RGQPRRHLLT TGWSVFVSSK KLVAGDAFIF LRGENEELRV GVRRHMRQQT SIPSSVISSH  240
SMHIGVLATA AHAIKTGTIF SVFYKPRTSR SEFIVSVNRY LEAKTQKLSV GMRFKMRFEG  300
EEAPEKRFSG TIVGVQENKS SVWHDSEWRS LKVQWDEPSS VFRPERVSPW ELEPLVANST  360
PSSQPQPPQR NKRPRPPGLP SPTTGPSAPD GVWKSPADTP SSVPLFSPPA KAATFGDGGN  420
KSFGVSIGSA FWPSRADSAA ESFASAFNNE PTEKKQTNGN VCRLFGFELV ENINLDECFS  480
AASVSGAVAV DQPIPSSEFD SGQQSEPLNI NQSDIPSGSG DPEKSSLRSP QESQSRQIRS  540
CTKVHMQGSA VGRAVDLTRS ECYEDLFKKL EEMFDIKGEL LESTKKWQVV YTDDEDDMMM  600
VGDDPWNEFC GMVRKIFIYT PEEVKKLSPK NKLAVNARMQ PKTDVEENGN TEGRSSSMAG  660
SR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.013591359Auxin response factor 1
4ldw_A0.013591359Auxin response factor 1
4ldw_B0.013591359Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1371375KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1337230.0AY133723.1 Arabidopsis thaliana auxin response factor 1 (At1g59750) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_849830.10.0auxin response factor 1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLB9DGM90.0B9DGM9_ARATH; Auxin response factor
STRINGAT1G59750.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.20.0auxin response factor 1